For research use only. Not for human consumption. Not medical advice — consult a licensed clinician.

Healing & Recovery

Teriparatide

Also known as: PTH 1-34, Parathyroid Hormone (1-34), rhPTH(1-34), Forteo, Bonsity

FDA approved

Recombinant human parathyroid hormone fragment consisting of the biologically active N-terminal 34 amino acids of endogenous PTH (PTH 1-34). It is a PTH1 receptor (PTH1R) agonist; when administered as a once-daily intermittent injection it preferentially stimulates osteoblast-mediated bone formation, increasing bone mineral density and reducing fracture risk. Teriparatide is FDA-approved (originally as Forteo, approved 2002) for osteoporosis at high fracture risk in postmenopausal women, men, and glucocorticoid-induced osteoporosis, and was the first anabolic (bone-building) osteoporosis therapy. It is one of the few peptides in this directory with full FDA marketing approval.

Where to buy · live market data

Who's worth your money for Teriparatide

Every current seller, ranked by independent evidence — Merit Score, latest COA purity, and live $/mg (size-normalized). Prices refresh daily. Rankings are never paid.

Average price

/mg

Sellers

3

45-day trend

building…

0 of 3 sellers have a current price

Prices observed from public storefronts (last 24h), normalized to $/mg. "Evidence" is Merit's 0–100 Merit Score, derived only from observable verification evidence (methodology on /about); "Purity" is the latest independent COA. Some buy links are affiliate links — Merit may earn a commission at no extra cost to you, and where a vendor offers one, the code shown gets you a discount at their checkout. Affiliate status never affects price data, ranking, or the Merit Score (full policy on /disclosure). Research use only.

Watch Teriparatide

Get one email when the market actually moves — no newsletter, no noise.

Compound reference

About Teriparatide

CAS

52232-67-4

Molecular formula

C181H291N55O51S2

Sequence

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

Typical dose range

20 mcg once daily subcutaneous (approved labeling); maximum cumulative use historically limited to ~2 years

Half-life

~1 hour after subcutaneous injection (serum), though the systemic exposure window is short; longer than after intravenous administration (~5 minutes)

Common research uses

treatment of osteoporosis at high fracture risk (FDA-approved)glucocorticoid-induced osteoporosis (FDA-approved)off-label investigational use in fracture healing and bone defects

Safety notes

FDA-approved. Labeling carried a boxed warning for osteosarcoma based on rat studies (the 2-year cumulative-use limit and boxed warning were removed by the FDA in 2020 after long-term human data did not show increased osteosarcoma risk). Contraindicated/cautioned in patients at increased baseline osteosarcoma risk (e.g., Paget disease, prior skeletal radiation, unexplained elevated alkaline phosphatase). Common effects include orthostatic hypotension and transient hypercalcemia. Not a WADA-prohibited substance.

Reconstitution

Supplied as a prefilled multi-dose pen; refrigerate (2-8 C), do not freeze, and use within the labeled in-use period after first injection.

Research depth

20 citations indexed for Teriparatide

All research on Teriparatide →

Study · 2026

Teriparatide treatment of osteoporosis in solid organ transplant recipients-a single-center experience

Solid organ transplant recipients face high fracture risk with limited evidence guiding anabolic therapy. In this real-world cohort, teriparatide was associated with significant improvements in bone mineral density and acceptable safety without adverse graft effects.

review · 2026

Restoring skeletal remodeling in antiresorptive-treated patients: clinical outcomes of teriparatide in medication-related osteonecrosis of the jaw

Medication-related osteonecrosis of the jaw (MRONJ) is a challenging complication associated with antiresorptive and antiangiogenic therapies. Prolonged suppression of bone remodeling has been implicated as a key mechanism in its pathophysiology.

meta-analysis · 2026

Teriparatide Therapy in Children with Hypoparathyroidism: A Systematic Review and Meta-Analysis

Hypoparathyroidism in children is conventionally treated with calcium and active vitamin D, however, this approach does not restore parathyroid hormone (PTH) action and may leave hyperphosphatemia unresolved while increasing the risk of hypercalciuria.

cohort · 2026

Comparison of Structurally Related Impurity Profiles in Teriparatide From Synthetic and Recombinant DNA Origin Using Liquid Chromatography-High Resolution Mass Spectrometry

Rationale Teriparatide (TPT) is a synthetic peptide primarily used in the clinical treatment of osteoporosis, with its reference materials available from both synthetic and recombinant DNA origin used for generic drug preparations.

review · 2026

Association of Perioperative Teriparatide Use with Postoperative Complications in Spinal Fusion Surgery: A Systematic Review and Meta-Analysis

Background/Objectives: Teriparatide, a recombinant form of parathyroid hormone used for the treatment of osteoporosis, has also been investigated in patients undergoing spinal fusion surgery.

Study · 2026

Impact of Preoperative Teriparatide Use on Proximal Junctional Kyphosis Prevention in Osteopenic/Osteoporotic Patients Undergoing Adult Spinal Deformity Surgery: A Propensity Score-Matched Study

Background/Objectives : Poor bone quality significantly increases the risk of mechanical complications after adult spinal deformity (ASD) surgery, including proximal junctional kyphosis (PJK) and proximal junctional failure (PJF).