Teriparatide
Also known as: PTH 1-34, Parathyroid Hormone (1-34), rhPTH(1-34), Forteo, Bonsity
Recombinant human parathyroid hormone fragment consisting of the biologically active N-terminal 34 amino acids of endogenous PTH (PTH 1-34). It is a PTH1 receptor (PTH1R) agonist; when administered as a once-daily intermittent injection it preferentially stimulates osteoblast-mediated bone formation, increasing bone mineral density and reducing fracture risk. Teriparatide is FDA-approved (originally as Forteo, approved 2002) for osteoporosis at high fracture risk in postmenopausal women, men, and glucocorticoid-induced osteoporosis, and was the first anabolic (bone-building) osteoporosis therapy. It is one of the few peptides in this directory with full FDA marketing approval.
Who's worth your money for Teriparatide
Every current seller, ranked by independent evidence — Merit Score, latest COA purity, and live $/mg (size-normalized). Prices refresh daily. Rankings are never paid.
Top Merit pick
Highest Merit Score (88) of 1 scored sellers
$15.00 · 10mg · 99.6% purity
Average price
$90.50/mg
Sellers
3
45-day trend
0%
3 of 3 sellers have a current price· 2 unverified hidden
- 🇺🇸 Arcane Peptides88
✓ verified at source · 23h ago
$1.50/mg -98.3% vs avg$15.00
10mg
Prices observed from public storefronts (last 24h), normalized to $/mg. "Evidence" is Merit's 0–100 Merit Score, derived only from observable verification evidence (methodology on /about); "Purity" is the latest independent COA. Some buy links are affiliate links — Merit may earn a commission at no extra cost to you, and where a vendor offers one, the code shown gets you a discount at their checkout. Affiliate status never affects price data, ranking, or the Merit Score (full policy on /disclosure). Research use only.
Watch Teriparatide
Get one email when the market actually moves — no newsletter, no noise.
About Teriparatide
CAS
52232-67-4
Molecular formula
C181H291N55O51S2
Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Typical dose range
20 mcg once daily subcutaneous (approved labeling); maximum cumulative use historically limited to ~2 years
Half-life
~1 hour after subcutaneous injection (serum), though the systemic exposure window is short; longer than after intravenous administration (~5 minutes)
Common research uses
Safety notes
FDA-approved. Labeling carried a boxed warning for osteosarcoma based on rat studies (the 2-year cumulative-use limit and boxed warning were removed by the FDA in 2020 after long-term human data did not show increased osteosarcoma risk). Contraindicated/cautioned in patients at increased baseline osteosarcoma risk (e.g., Paget disease, prior skeletal radiation, unexplained elevated alkaline phosphatase). Common effects include orthostatic hypotension and transient hypercalcemia. Not a WADA-prohibited substance.
Reconstitution
Supplied as a prefilled multi-dose pen; refrigerate (2-8 C), do not freeze, and use within the labeled in-use period after first injection.
COAs for Teriparatide
4 third-party tests across 2 vendors. Each card links to the full report.
For
Teriparatide
by Arcane Peptides
For
Teriparatide
by Arcane Peptides· batch Unknown
For
Teriparatide
by Orbitrex Peptides· batch TERA101225
Purity not on file
For
Teriparatide
by Arcane Peptides
20 citations indexed for Teriparatide
cohort · 2026
Comparison of Structurally Related Impurity Profiles in Teriparatide From Synthetic and Recombinant DNA Origin Using Liquid Chromatography-High Resolution Mass Spectrometry
Rationale Teriparatide (TPT) is a synthetic peptide primarily used in the clinical treatment of osteoporosis, with its reference materials available from both synthetic and recombinant DNA origin used for generic drug preparations.
review · 2026
Influence of bisphosphonate pretreatment on bone mineral density gains and fracture outcomes with teriparatide: A systematic review and meta-analysis
Purpose Teriparatide is a potent anabolic therapy for osteoporosis and is frequently prescribed after prior bisphosphonate (BP) treatment in routine clinical practice. Whether such pretreatment alters teriparatide efficacy, particularly with respect to fracture outcomes, remains uncertain.
review · 2026
The Effect of Teriparatide in a Brown Tumor Patient With Pathological Hip Fracture: A Case Report and Literature Review
Case A 32-year-old man with end-stage renal disease (ESRD) from anti-neutrophil cytoplasmic antibody-associated vasculitis and tertiary hyperparathyroidism, presented with progressive right hip pain. A giant cell-rich lesion biopsy confirmed Brown tumor.
case-report · 2026
Use of teriparatide for treatment of a 3-year-old child with an activating calcium sensing receptor mutation
Calcium sensing receptor (CaSR) variants are a rare cause of congenital hypoparathyroidism. Current standard treatment consists of calcitriol and calcium supplements, but this regimen increases the risk of kidney complications due to hypercalciuria.
case-report · 2026
Teriparatide for the treatment of primary hypoparathyroidism in children
In this retrospective case series, the clinical data of four pediatric patients with primary hypoparathyroidism (PHPT) treated with teriparatide at the Endocrinology Department of Capital Center for Children's Health, Capital Medical University, from May 2018 to May 2025, were analyzed.
rct · 2026
Teriparatide Plus Zoledronic Acid for Osteogenesis Imperfecta: A Randomized Clinical Trial
Importance Osteogenesis imperfecta causes multiple fractures throughout life, causing substantial morbidity. Objective To determine whether the parathyroid hormone analogue teriparatide followed by zoledronic acid reduces the risk of fractures in adults with osteogenesis imperfecta.