Liraglutide
Also known as: Victoza
Liraglutide is an FDA-approved GLP-1 receptor agonist marketed as Victoza (type 2 diabetes, approved 2010) and Saxenda (chronic weight management, approved 2014). It was the first GLP-1 analog approved for obesity and carries an FDA boxed warning for the risk of thyroid C-cell tumors. Pediatric indications include type 2 diabetes in patients ≥10 years (Victoza) and obesity in patients ≥12 years with BMI ≥95th percentile (Saxenda).
Who's worth your money for Liraglutide
Every current seller, ranked by independent evidence — Merit Score, latest COA purity, and live $/mg (size-normalized). Prices refresh daily. Rankings are never paid.
Average price
$3.33/mg
Sellers
1
45-day trend
building…
1 of 1 sellers have a current price· 1 stale hidden
- No fresh prices — all 1 listing are older than 7 days.
Prices observed from public storefronts (last 24h), normalized to $/mg. "Evidence" is Merit's 0–100 Merit Score, derived only from observable verification evidence (methodology on /about); "Purity" is the latest independent COA. Some buy links are affiliate links — Merit may earn a commission at no extra cost to you, and where a vendor offers one, the code shown gets you a discount at their checkout. Affiliate status never affects price data, ranking, or the Merit Score (full policy on /disclosure). Research use only.
Watch Liraglutide
Get one email when the market actually moves — no newsletter, no noise.
About Liraglutide
CAS
204656-20-2
Molecular formula
C172H265N43O51
Sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVRGR
Typical dose range
0.6–1.8 mg/day subcutaneous (diabetes); 0.6–3.0 mg/day subcutaneous (obesity/weight management)
Half-life
~13 hours
No COAs on file for Liraglutide
No independent third-party test has been located or submitted yet. Absence isn't a red flag — just no evidence catalogued for Liraglutide so far; we add COAs as we find them.
20 citations indexed for Liraglutide
animal · 2026
Liraglutide ameliorates obese type 2 diabetes by regulating macrophage cholesterol metabolism and H3K27ac modification to promote M2 polarization and adipocyte thermogenic activation
Obesity-related type 2 diabetes mellitus (O&T2DM) has become a major global public health issue.
Study · 2026
Recovery from liraglutide-induced acute liver injury assessed for causality using the updated RUCAM as global gold standard: A case report and literature review
Liraglutide is a glucagon-like peptide-1 receptor agonist (GLP-1RA) widely used for managing type 2 diabetes mellitus (T2DM) and obesity. Reports of liraglutide-associated hepatotoxicity are exceedingly rare.
review · 2026
Effects of liraglutide on blood pressure and renal function in patients with type 2 diabetic nephropathy: a meta-analysis of randomized controlled trials
Objectives The effects of liraglutide on blood pressure in patients with T2DN remain unclear. This meta-analysis aimed to systematically evaluate the effects of liraglutide on blood pressure and renal function in patients with T2DN.
animal · 2026
Effects of Liraglutide and Semaglutide on Cardiometabolic Dysregulation and Oxidative Stress in an Experimental Model of Metabolic Syndrome
Background/objectives Metabolic syndrome (MetS) increases susceptibility to myocardial ischemia/reperfusion (I/R) injury through metabolic disturbance, hypertension, and oxidative stress.
Study · 2026
Parabrachial CGRP neurons mediate incretin-induced aversion and anti-aversion, but not anorexia or weight loss
Incretin mimetics such as the glucagon-like peptide-1 receptor agonist (GLP-1RA) liraglutide cause decreased food intake, weight loss, and aversion. Here, we examined the extent to which parabrachial calcitonin gene-related peptide (CGRP) neurons contribute to these effects.
Study · 2026
Liraglutide reduces lipid accumulation in human orbital fibroblasts in Graves' orbitopathy
Graves' orbitopathy (GO) is characterized by proliferation and differentiation of orbital fibroblasts. Glucagon-like peptide-1 receptor agonists (GLP-1RAs) are widely used for metabolic disorders and have been reported to modulate cell proliferation and differentiation.