Liraglutide
Also known as: Victoza
Liraglutide is an FDA-approved GLP-1 receptor agonist marketed as Victoza (type 2 diabetes, approved 2010) and Saxenda (chronic weight management, approved 2014). It was the first GLP-1 analog approved for obesity and carries an FDA boxed warning for the risk of thyroid C-cell tumors. Pediatric indications include type 2 diabetes in patients ≥10 years (Victoza) and obesity in patients ≥12 years with BMI ≥95th percentile (Saxenda).
Who's worth your money for Liraglutide
Every current seller, ranked by independent evidence — Merit Score, latest COA purity, and live $/mg (size-normalized). Prices refresh daily. Rankings are never paid.
Average price
$3.33/mg
Sellers
1
45-day trend
-71.4%
1 of 1 sellers have a current price· 1 stale hidden
- No fresh prices — all 1 listing are older than 7 days.
Prices observed from public storefronts (last 24h), normalized to $/mg. "Evidence" is Merit's 0–100 Merit Score, derived only from observable verification evidence (methodology on /about); "Purity" is the latest independent COA. Some buy links are affiliate links — Merit may earn a commission at no extra cost to you, and where a vendor offers one, the code shown gets you a discount at their checkout. Affiliate status never affects price data, ranking, or the Merit Score (full policy on /disclosure). Research use only.
Watch Liraglutide
Get one email when the market actually moves — no newsletter, no noise.
About Liraglutide
CAS
204656-20-2
Molecular formula
C172H265N43O51
Sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVRGR
Typical dose range
0.6–1.8 mg/day subcutaneous (diabetes); 0.6–3.0 mg/day subcutaneous (obesity/weight management)
Half-life
~13 hours
No COAs on file for Liraglutide
No independent third-party test has been located or submitted yet. Absence isn't a red flag — just no evidence catalogued for Liraglutide so far; we add COAs as we find them.
20 citations indexed for Liraglutide
in-vitro · 2026
Liraglutide Attenuates Hepatocyte Ferroptosis in an In Vitro Model of Metabolic Dysfunction-Associated Steatotic Liver Disease
This study examined the potential of liraglutide to attenuate ferroptosis in an in vitro model of metabolic dysfunction-associated steatotic liver disease (MASLD). HepG2 cells were allocated into three groups: control (Con), free fatty acid (FFA)-treated, and FFA with liraglutide treatment (FFA+LI).
case-report · 2026
Successful Reversal of Tamoxifen-Associated Weight Gain and Metabolic Dysfunction with Liraglutide in a Breast Cancer Survivor: A Case Report
Introduction: Adjuvant endocrine therapy for breast cancer - particularly tamoxifen - is commonly associated with weight gain, increased adiposity, and metabolic dysfunction. Lifestyle measures often fail to reverse these effects.
animal · 2026
Effects of liraglutide on gut bacterial community dynamics
Liraglutide, a GLP-1 receptor agonist, is used to induce weight loss. However, limited information exists on liraglutide's effects on the gut bacterial community and their restoration after washout.
Study · 2026
Psychiatric and eye disorders associated with use of glucagon-like peptide 1 receptor agonists (GLP-1 RAs)
Glucagon-like peptide 1 receptor agonists (GLP-1 RAs) semaglutide, liraglutide, and dulaglutide are indicated for diabetes. Semaglutide and liraglutide were also approved for therapy of obesity or weight control. Apprehension has been expressed about the possible link between GLP-1 RAs and suicidality.
in-vitro · 2026
An Orthogonal Framework for Higher-Order Structural and In Vitro Functional Comparability of Chemically Synthesized Liraglutide Relative to an rDNA-Origin Reference Product
Purpose Synthetic peptide test products referencing recombinant-origin products present unique regulatory challenges in demonstrating higher-order structural (HOS) comparability beyond primary sequence sameness.
animal · 2026
Liraglutide reprograms vascular smooth muscle cell metabolism to suppress extracellular matrix remodeling in diabetic atherosclerosis
Background Metabolic reprogramming contributes to vascular dysfunction in diabetic atherosclerosis, but the mechanisms linking hyperglycemia-induced metabolic alterations to extracellular matrix remodeling in vascular smooth muscle cells remain incompletely understood.