Liraglutide
Also known as: Victoza
Liraglutide is an FDA-approved GLP-1 receptor agonist marketed as Victoza (type 2 diabetes, approved 2010) and Saxenda (chronic weight management, approved 2014). It was the first GLP-1 analog approved for obesity and carries an FDA boxed warning for the risk of thyroid C-cell tumors. Pediatric indications include type 2 diabetes in patients ≥10 years (Victoza) and obesity in patients ≥12 years with BMI ≥95th percentile (Saxenda).
Who's worth your money for Liraglutide
Every current seller, ranked by independent evidence — Merit Score, latest COA purity, and live $/mg (size-normalized). Prices refresh daily. Rankings are never paid.
Average price
$3.33/mg
Sellers
1
45-day trend
-71.4%
1 of 1 sellers have a current price· 1 unverified hidden
Prices observed from public storefronts (last 24h), normalized to $/mg. "Evidence" is Merit's 0–100 Merit Score, derived only from observable verification evidence (methodology on /about); "Purity" is the latest independent COA. Some buy links are affiliate links — Merit may earn a commission at no extra cost to you, and where a vendor offers one, the code shown gets you a discount at their checkout. Affiliate status never affects price data, ranking, or the Merit Score (full policy on /disclosure). Research use only.
Watch Liraglutide
Get one email when the market actually moves — no newsletter, no noise.
About Liraglutide
CAS
204656-20-2
Molecular formula
C172H265N43O51
Sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVRGR
Typical dose range
0.6–1.8 mg/day subcutaneous (diabetes); 0.6–3.0 mg/day subcutaneous (obesity/weight management)
Half-life
~13 hours
No COAs on file for Liraglutide
No independent third-party test has been located or submitted yet. Absence isn't a red flag — just no evidence catalogued for Liraglutide so far; we add COAs as we find them.
20 citations indexed for Liraglutide
Study · 2026
Comparison between liraglutide and dulaglutide on the incidence or progression of eye and kidney complications
Aims To evaluate and compare the risk of diabetic retinopathy and kidney disease between once-daily liraglutide and once-weekly dulaglutide in Japanese participants with type 2 diabetes (T2D).
Study · 2026
Optimal Timing for Initiating Liraglutide 3.0 mg in Patients With Persistent Obesity Six Months After Metabolic and Bariatric Surgery
Objectives To determine the optimal timing for initiating liraglutide in patients with persistent obesity (BMI ≥ 28 kg/m² in China) six months after metabolic and bariatric surgery, a key gap in postoperative weight management.
animal · 2026
Effects of the GLP-1 receptor agonist liraglutide on bupivacaine-induced sciatic nerve block in a rat model
Purpose Glucagon-like peptide-1 receptor agonists exhibit neuroprotective and anti-inflammatory effects; however, their role as perineural adjuvants in peripheral nerve blocks has not been investigated.
animal · 2026
Liraglutide Potently Protects Against Streptozotocin-Induced Islet Injury Associated with Inhibition of HMGB1 Release
It is unknown whether the glucagon-like peptide-1 (GLP-1) receptor agonists have a significant protective effect against acute islet injury.
animal · 2026
Liraglutide, a GLP-1 Receptor Agonist, Mitigates LPS-Induced Osteoclastogenesis and Bone Loss by Downregulating Macrophage TNF-α Expression
Liraglutide, a glucagon-like peptide-1 (GLP-1) receptor agonist, restores hyperglycemic conditions in patients with type 2 diabetes and has recently shown promising anti-inflammatory properties.
case-report · 2026
Liraglutide-Induced Acute Hepatocellular Injury With Positive Rechallenge: A Case Report and Literature Review
Glucagon-like peptide-1 receptor agonist liraglutide is widely used in type 2 diabetes mellitus and obesity and is generally considered non-hepatotoxic, with only rare reports of idiosyncratic liver injury.