Which vendors sell IGF-1 LR3 with independent COA testing?

25 vendors in the Merit Verified directory have independent COA evidence on file for IGF-1 LR3 — 68 COAs total. COA coverage and test dates are listed on the IGF-1 LR3 page at https://meritverified.org/peptides/igf-1-lr3.

How do I verify the quality of IGF-1 LR3 from a vendor?

To verify IGF-1 LR3 quality, look for an independent certificate of analysis (COA) from a third-party lab — not a lab the vendor owns or pays directly. The COA should state the tested compound, lot number, purity percentage (identity and concentration), and the lab's name. Cross-reference the lot number against the vendor's current stock. Merit Verified indexes COAs for IGF-1 LR3 at https://meritverified.org/peptides/igf-1-lr3 so you can compare evidence across vendors before buying.

What is the regulatory status of IGF-1 LR3?

IGF-1 LR3 is tracked in the Merit Verified registry. Regulatory status for research peptides in the US has been evolving — the FDA has reclassified a number of peptides out of the 503A compounding ingredient list since 2025. Merit Verified does not provide legal or regulatory advice; check official FDA sources or consult a licensed professional for the current status of IGF-1 LR3 in your jurisdiction.

Growth Hormone Secretagogues

IGF-1 LR3

Also known as: Long R3 IGF-1

IGF-1 LR3 is an 83-amino-acid modified IGF-1 analog with a 13-residue N-terminal extension (MFPAMPLSSLFVN) and an Arg-3 substitution. These modifications reduce binding to IGF binding proteins (IGFBPs), extending effective half-life and increasing tissue bioavailability relative to native IGF-1. It is a research/cell-culture reagent and is NOT FDA-approved for any human use. Do not confuse with mecasermin (Increlex), which is recombinant human IGF-1 and IS FDA-approved for severe primary IGF-1 deficiency.

Where to buy · live market data

Who's worth your money for IGF-1 LR3

Every current seller, ranked by independent evidence — Merit Score, latest COA purity, and live $/mg (size-normalized). Prices refresh daily. Rankings are never paid.

Top Merit pick

🇺🇸 Glacier Aminos 99

Highest Merit Score (99) of 21 scored sellers

$64.99/mg

$64.99 · 1mg

no COAs yet

Buy Code MERIT · 10% off

Best value

🇨🇳 Qing Li Peptide 59

Lowest $/mg among scored sellers

$0.00/mg

— · 1mg · 99.3% purity

1 COA

Buy

Most tested

🇺🇸 Verified Peptides 87

7 independent COAs on file

$65.00/mg

$65.00 · 1mg · 99.8% purity

7 COAs

Buy

Average price

$70.21/mg

range $0.00–$150.00/mg

Sellers

from $48.00

45-day trend

-18.2%

vs 45-day avg $/mg

28 of 46 sellers have a current price· 3 stale hidden· 4 unverified hidden

	Vendor	Price	$/mg	vs avg	Purity	COAs	Merit
🇺🇸	Glacier Aminos ✓ verified at source · 10h ago	$64.99· 1mg	$64.99/mg	-7.4%	—	—	99	Buy Code MERIT · 10% off
🇺🇸	Peptide Crafters ✓ verified at source · 10h ago	$65.00· 1mg	$65.00/mg	-7.4%	99.8%	3	94	Buy Code CRAFTERS10 · 10% off
	Nova Peptides via Disclosed Labs · 10h ago	$79.99· 1mg	$79.99/mg	+13.9%	99.8%	3	94	Buy
🇺🇸	Riptide Wellness ✓ verified at source · 9h ago	$76.76· 1mg	$76.76/mg	+9.3%	—	—	92	Buy
🇺🇸	Polaris Peptides via Disclosed Labs · 10h ago	$85.00· 1mg	$85.00/mg	+21.1%	—	—	90	Buy
🇺🇸	Peptide Plugs ✓ verified at source · 1d ago	$70.00· 1mg	$70.00/mg	-0.3%	99.1%	1	89	Buy
🇺🇸	Peptidology ✓ verified at source · 3d ago · stale	$77.40· 1mg	$77.40/mg	+10.2%	99.6%	2	89	Buy
🇺🇸	Soma Peptides ✓ verified at source · 1d ago	$93.00· 1mg	$93.00/mg	+32.5%	99.4%	1	89	Buy
	Welli Labs via Disclosed Labs · 10h ago	$450· 10mg	$45.00/mg	-35.9%	—	—	87	Buy
🇺🇸	Verified Peptides ✓ verified at source · 9h ago	$65.00· 1mg	$65.00/mg	-7.4%	99.8%	7	87	Buy

Top Merit pick

🇺🇸 Glacier Aminos
✓ verified at source · 10h ago
99

$64.99/mg -7.4% vs avg

$64.99

1mg

no purity

Buy Code MERIT · 10% off
🇺🇸 Peptide Crafters
✓ verified at source · 10h ago
94

$65.00/mg -7.4% vs avg

$65.00

1mg

99.8% purity 3 COAs

Buy Code CRAFTERS10 · 10% off
Nova Peptides
via Disclosed Labs · 10h ago
94

$79.99/mg +13.9% vs avg

$79.99

1mg

99.8% purity 3 COAs

Buy
🇺🇸 Riptide Wellness
✓ verified at source · 9h ago
92

$76.76/mg +9.3% vs avg

$76.76

1mg

no purity

Buy
🇺🇸 Polaris Peptides
via Disclosed Labs · 10h ago
90

$85.00/mg +21.1% vs avg

$85.00

1mg

no purity

Buy
🇺🇸 Peptide Plugs
✓ verified at source · 1d ago
89

$70.00/mg -0.3% vs avg

$70.00

1mg

99.1% purity 1 COA

Buy
🇺🇸 Peptidology
✓ verified at source · 3d ago · stale
89

$77.40/mg +10.2% vs avg

$77.40

1mg

99.6% purity 2 COAs

Buy
🇺🇸 Soma Peptides
✓ verified at source · 1d ago
89

$93.00/mg +32.5% vs avg

$93.00

1mg

99.4% purity 1 COA

Buy
Welli Labs
via Disclosed Labs · 10h ago
87

$45.00/mg -35.9% vs avg

$450

10mg

no purity

Buy
🇺🇸 Verified Peptides
✓ verified at source · 9h ago
87

$65.00/mg -7.4% vs avg

$65.00

1mg

99.8% purity 7 COAs

Buy

Prices observed from public storefronts (last 24h), normalized to $/mg. "Evidence" is Merit's 0–100 Merit Score, derived only from observable verification evidence (methodology on /about); "Purity" is the latest independent COA. Some buy links are affiliate links — Merit may earn a commission at no extra cost to you, and where a vendor offers one, the code shown gets you a discount at their checkout. Affiliate status never affects price data, ranking, or the Merit Score (full policy on /disclosure). Research use only.

Watch IGF-1 LR3

Get one email when the market actually moves — no newsletter, no noise.

Compound reference

About IGF-1 LR3

CAS

143045-27-6

Molecular formula

C400H619N111O115S9

Sequence

MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Typical dose range

20-100 mcg/day subcutaneous or intramuscular injection (research use; commonly 20-50 mcg/day in published protocols)

Half-life

~20-30 hours

Independent evidence

COAs for IGF-1 LR3

68 third-party tests across 25 vendors. Each card links to the full report.

All 68 COAs for IGF-1 LR3 →

Measured purity over time

IGF-1 LR3

Who's worth your money for IGF-1 LR3

Watch IGF-1 LR3

About IGF-1 LR3

COAs for IGF-1 LR3

12 citations indexed for IGF-1 LR3

IGF-1 Increases Collagen Deposition by Dermal Fibroblasts: Applications for Tissue Engineering

The emerging landscape of performance-enhancing peptides modulating GH-IGF1 axis: bridging the gap between clinical evidence and patient self-administration

Intact Proteoform Analysis by Capillary Electrophoresis-Mass Spectrometry. Are We There Yet?

Therapeutic Peptides in Aesthetic, Metabolic and Endocrine Conditions: Effects, Safety, Clinical Applications, and Future Perspectives

Self-Organized Vascularized Human Liver Spheroids: Serum-Free Culture Conditions and Use as Tissue Building Blocks

Growth factor thermostability dataset derived from experimental and computational approaches to accelerate cultured meat development